PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EcC055196.40
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family GATA
Protein Properties Length: 353aa    MW: 38257.4 Da    PI: 7.4525
Description GATA family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EcC055196.40genomeECGDView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GATA59.25.5e-19273306134
          GATA   1 CsnCgttkTplWRrgpdgnktLCnaCGlyyrkkg 34 
                   Cs+Cg+ kTp+WR gp g ktLCnaCG+++++ +
  EcC055196.40 273 CSHCGVQKTPQWRAGPLGAKTLCNACGVRFKSGR 306
                   *******************************987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PIRSFPIRSF0169921.3E-785351IPR016679Transcription factor, GATA, plant
PROSITE profilePS5011411.78267303IPR000679Zinc finger, GATA-type
SMARTSM004017.3E-15267321IPR000679Zinc finger, GATA-type
SuperFamilySSF577168.08E-14268329No hitNo description
Gene3DG3DSA:3.30.50.101.6E-14271304IPR013088Zinc finger, NHR/GATA-type
CDDcd002027.84E-14272328No hitNo description
PfamPF003208.6E-17273306IPR000679Zinc finger, GATA-type
PROSITE patternPS003440273298IPR000679Zinc finger, GATA-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0008168Molecular Functionmethyltransferase activity
GO:0008270Molecular Functionzinc ion binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 353 aa     Download sequence    Send to blast
MECVEAALKM SFRREMAARP FVRDEVVWPA ASNSLNASSS DDFLVDELLD FSNDEGFVQA  60
HEKEEGEERN PKEEGGEGEG EGGERAAKKL ISSASCSAEE RFSAKTEDFG PLPASELSVP  120
DDDLADLEWL SHFVDDSFSE FSSPLPAVFP AEKPRNPQSH QNRSGPEAPA MGKPHFATPA  180
QAKSRRSKRA RTGGRVWSLG SPSLTDASSS SCSSSSSSNS PASNWLACTT PPARKSSEPP  240
ENVAYSDRKP PVKKQKRPDQ PAPGAAQPPA RRCSHCGVQK TPQWRAGPLG AKTLCNACGV  300
RFKSGRLFPE YRPACSPTFS SEMHSNHHRK VVEMRRKKEV PGQSGSAQAV PSF
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010029716.10.0PREDICTED: GATA transcription factor 5-like
SwissprotQ9FH577e-72GATA5_ARATH; GATA transcription factor 5
TrEMBLA0A059ARS00.0A0A059ARS0_EUCGR; Uncharacterized protein
STRINGVIT_04s0023g02880.t016e-89(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G66320.29e-44GATA transcription factor 5